Overview

  • Product name

    Recombinant Human Claudin 6 protein (Tagged)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Cell free
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGL WMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
    • Molecular weight

      25 kDa including tags
    • Amino acids

      1 to 82
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tag (in vitro E.coli expression system).

Specifications

Our Abpromise guarantee covers the use of ab235014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    Purified from an in vitro E.coli expression system.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Claudin-6
    • Claudin6
    • CLD6_HUMAN
    • CLDN 6
    • CLDN6
    • OTTHUMP00000159248
    • Skullin
    • Skullin 2
    • UNQ757/PRO1488
    see all
  • Function

    Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235014.

References

ab235014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up