Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHS VSDAFSGWLLMLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEH CCWNSEHVTFEERDKCPEWNSWSQLIISTDEGAFAYIVNYFMYVLWALLF AFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLVIKTITLVL AVSSGLSLGKEGPLVHVACCCGNILCHCFNKYRKNEAKRREVLSAAAAAG VSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGN SRLVLFYVEFHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTT QLGKYPVIEVLVVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKL CDYENRFNTSKGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKI PSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQEWTVFNSWCSQGADCITPG LYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAAAMTSKWVAD ALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQ DSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKK QDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVV DIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSILFN
    • Amino acids
      1 to 746
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chloride Channel 5
    • Chloride channel protein 5
    • Chloride channel voltage sensitive 5
    • Chloride transporter ClC-5
    • ClC-5
    • CLC5
    • CLCK2
    • CLCN5
    • CLCN5_HUMAN
    • DENTS
    • H(+)/Cl(-) exchange transporter 5
    • hCIC-K2
    • NPHL1
    • NPHL2
    • Voltage gated chloride ion channel CLCN5
    • XLRH
    • XRN
    see all
  • Function
    Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Important for normal acidification of the endosome lumen. May play an important role in renal tubular function.
  • Tissue specificity
    Kidney. Moderately expressed in aortic vascular smooth muscle and endothelial cells, and at a slightly higher level in the coronary vascular smooth muscle.
  • Involvement in disease
    Hypophosphatemic rickets, X-linked recessive
    Nephrolithiasis 2
    Nephrolithiasis 1
    Low molecular weight proteinuria with hypercalciuria and nephrocalcinosis
  • Sequence similarities
    Belongs to the chloride channel (TC 2.A.49) family. ClC-5/CLCN5 subfamily.
    Contains 2 CBS domains.
  • Post-translational
    modifications
    Ubiquitinated by NEDD4L in the presence of albumin; which promotes endocytosis and proteasomal degradation.
  • Cellular localization
    Golgi apparatus membrane. Endosome membrane. Cell membrane.
  • Information by UniProt

Images

  • ab158134 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up