Overview

  • Product name

    Recombinant Human CLCNKB protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW YFLMTLGVLMALVSCAMDLAVESVVRAHQWLYREIGDSHLLRYLSWTVYP VALVSFSSGFSQSITPSSGGSGIPEVKTMLAGVVLEDYLDIKNFGAKVVG LSCTLACGSTLFLGKVGPFVHLSVMMAAYLGRVRTTTIGEPENKSKPVYS ALATLVLASITYPPSAGRFLASRLSMKQHLDSLFDNHSWALMTQNSSPPW PEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIPMPAGYFMP IFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAV THTISTALLAFEVTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKK LPYLPRILGRNIGSHRVRVEHFMNHSITTLAITLMNDEIGVHCHQGQAQM ASGVVWFPVRGS
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 462

Specifications

Our Abpromise guarantee covers the use of ab132496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bartter syndrome type 3
    • Chloride channel Kb
    • Chloride channel kidney B
    • Chloride channel protein ClC-Kb
    • Chloride channel voltage sensitive Kb
    • ClC K2
    • ClC-K2
    • ClCK2
    • CLCKB
    • CLCKB_HUMAN
    • CLCNKB
    • hClC Kb
    • hClCKb
    • MGC24087
    • OTTHUMP00000011120
    • OTTHUMP00000011121
    • RP11 5P18.8
    see all
  • Function

    Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport. May be important in urinary concentrating mechanisms.
  • Tissue specificity

    Expressed predominantly in the kidney.
  • Involvement in disease

    Defects in CLCNKB are the cause of Bartter syndrome type 3 (BS3) [MIM:607364]; also known as classic Bartter syndrome. It is an autosomal recessive form of often severe intravascular volume depletion due to renal salt-wasting associated with low blood pressure, hypokalemic alkalosis, hypercalciuria, and normal serum magnesium levels.
    Defects in CLCNKB are a cause of Bartter syndrome type 4B (BS4B) [MIM:613090]. A digenic, recessive disorder characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. Bartter syndrome type 4B is associated with sensorineural deafness.
  • Sequence similarities

    Belongs to the chloride channel (TC 2.A.49) family. CLCNKB subfamily.
    Contains 2 CBS domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132496 stained with Coomassie Blue.

References

ab132496 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132496.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up