Overview

  • Product name

    Recombinant Human CLEC14A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFEHPTADRAGCSASGACYSLHH ATMKRQAAEEACILRGGALSTVRAGAELRAVLALLRAGPGPGGGSKDLLF WVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARR CAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSY RAPFQLHSAALDFSPPGTEVSALCRGQLPISVTCIADEIGARWDKLSGDV LCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEG QPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTS IPEIPRWGSQSTMSTLQMSLQAESKATITPSGSVISKFNSTTSSATPQAF DSSSAV
    • Molecular weight

      43 kDa including tags
    • Amino acids

      22 to 398
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. Extracellular domain. NP_778230.

Specifications

Our Abpromise guarantee covers the use of ab182814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • C type lectin domain family 14, member A
    • C-type lectin domain family 14 member A
    • C14orf27
    • CEG1
    • CLC14_HUMAN
    • Clec14a
    • ClECT and EGF like domain containing protein
    • EGFR-5
    • EGFR5
    • Epidermal growth factor receptor 5
    see all
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up