Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLIWRLFFLIMFLTIIVC GMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQ RFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTE WTRQ
    • Molecular weight

      43 kDa including tags
    • Amino acids

      1 to 154

Specifications

Our Abpromise guarantee covers the use of ab132623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C type lectin related f
    • C type lectin superfamily 2, member D
    • C-type lectin domain family 2 member D
    • CLAX
    • CLC2D_HUMAN
    • CLEC2D
    • CLEC2D protein
    • Clec2d5
    • L LT1
    • Lectin like NK cell receptor
    • Lectin like transcript 1
    • Lectin-like NK cell receptor
    • Lectin-like transcript 1
    • LLT-1
    • LLT1
    • OCIL
    • Osteoclast inhibitory lectin
    see all
  • Function

    Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis. Inhibits osteoclast formation. Inhibits bone resorption. Modulates the release of interferon-gamma. Binds high molecular weight sulfated glycosaminoglycans.
  • Tissue specificity

    Detected in peripheral blood leukocytes, osteoblasts, lymph node, thymus and spleen. Isoform 1, isoform 2 and isoform 4 are expressed in T and B lymphocytes, and at lower levels in NK cells. They are also expressed in B-cell lines and LPS-matured monocyte-derived dendritic cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Endoplasmic reticulum and Cell membrane. Cell surface.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132623 stained with Coomassie Blue.

References

ab132623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up