Overview

  • Product name
    Recombinant Human CLEC4D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRA FQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLS YFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQD KWAWNDVPCNFEASRICKIPGTTLN
    • Amino acids
      41 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 8
    • C type lectin domain family 4, member D
    • C type lectin like receptor 6
    • C type lectin receptor
    • C type lectin superfamily member 8
    • C-type lectin domain family 4 member D
    • C-type lectin superfamily member 8
    • C-type lectin-like receptor 6
    • CLC4D_HUMAN
    • CLEC 6
    • CLEC-6
    • Clec4d
    • CLEC6
    • CLECSF8
    • lectin, C type, superfamily member 8
    • Macrophage C type lectin
    • MCL
    • MGC40078
    • MPCL
    see all
  • Function
    Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.
  • Tissue specificity
    Expressed weakly in peripheral blood leukocytes, bone marrow and spleen. Expression is confined mostly in monocytes and macrophage and seems to be up-regulated by IL-6, IL-10, TNF-alpha and IFN-gamma.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab166246 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up