Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQI FGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCK GKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNG NVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
    • Molecular weight

      48 kDa including tags
    • Amino acids

      1 to 188

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C type lectin domain family 5 member A
    • C-type lectin domain family 5 member A
    • C-type lectin superfamily member 5
    • CLC5A_HUMAN
    • CLEC5 A
    • CLEC5A
    • CLECSF 5
    • CLECSF5
    • MDL 1
    • MDL-1
    • MDL1
    • Myeloid DAP12 associating lectin
    • Myeloid DAP12-associating lectin 1
    see all
  • Function

    Functions as a positive regulator of osteoclastogenesis. Cell surface receptor that signals via TYROBP. Regulates inflammatory responses. Acts as a key regulator of synovial injury and bone erosion during autoimmune joint inflammation (By similarity). Critical macrophage receptor for dengue virus serotypes 1-4. The binding of dengue virus to CLEC5A triggers signaling through the phosphylation of TYROBP, this interaction does not result in viral entry, but stimulates proinflammatory cytokine release.
  • Tissue specificity

    Expressed in peripheral blood monocytes and in the monocyte/macrophage cell lines U-937 and Mono-Mac-6, but not in cell lines of other origins. Expression is down-regulated when monocytes differentiate into dendritic cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Post-translational
    modifications

    N-glycosylated. Contains sialic acid residues.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab132716 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up