Recombinant Human CLEC5A protein (denatured) (ab202186)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSPQIFNKSNDGFTTTRSYGTVSQIFGSS SPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGS TLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTN QNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
    • Molecular weight
      21 kDa including tags
    • Amino acids
      28 to 188
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_037384

Specifications

Our Abpromise guarantee covers the use of ab202186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.
    ab202186 was purified by conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names
    • C type lectin domain family 5 member A
    • C-type lectin domain family 5 member A
    • C-type lectin superfamily member 5
    • CLC5A_HUMAN
    • CLEC5 A
    • CLEC5A
    • CLECSF 5
    • CLECSF5
    • MDL 1
    • MDL-1
    • MDL1
    • Myeloid DAP12 associating lectin
    • Myeloid DAP12-associating lectin 1
    see all
  • Function
    Functions as a positive regulator of osteoclastogenesis. Cell surface receptor that signals via TYROBP. Regulates inflammatory responses. Acts as a key regulator of synovial injury and bone erosion during autoimmune joint inflammation (By similarity). Critical macrophage receptor for dengue virus serotypes 1-4. The binding of dengue virus to CLEC5A triggers signaling through the phosphylation of TYROBP, this interaction does not result in viral entry, but stimulates proinflammatory cytokine release.
  • Tissue specificity
    Expressed in peripheral blood monocytes and in the monocyte/macrophage cell lines U-937 and Mono-Mac-6, but not in cell lines of other origins. Expression is down-regulated when monocytes differentiate into dendritic cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    N-glycosylated. Contains sialic acid residues.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202186 (3 μg).

References

ab202186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up