Recombinant Human CLIC5 protein (ab151380)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CLIC5 protein
See all CLIC5 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMTDSATANGDDRDPEIELFVKAGIDGESIG NCPFSQRLFM ILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEE FLEETLTPEK YPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDD YLNTPLPEEI DANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE MTGLWRYLKN AYARDEFTNTCAADSE -
Predicted molecular weight
27 kDa including tags -
Amino acids
1 to 236 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151380 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionLyophilized from a 0.2 µM filtered solution. Dissolve the lyophilized protein in 1X PBS.
General Info
-
Alternative names
- Chloride intracellular channel 5
- Chloride intracellular channel 5A
- Chloride intracellular channel protein 5
see all -
Function
Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Required for normal formation of stereocilia in the inner ear and normal development of the organ of Corti (By similarity). Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture. -
Tissue specificity
Isoform 1: Expressed in renal glomeruli endothelial cells and podocytes (at protein level). -
Sequence similarities
Belongs to the chloride channel CLIC family.
Contains 1 GST C-terminal domain. -
Domain
Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion. -
Cellular localization
Cytoplasm > cell cortex. Cytoplasm > cytoskeleton. Membrane. Associates with the cortical actin cytoskeleton. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain and Golgi apparatus. Cytoplasm > cytoskeleton > centrosome. Membrane. Colocalized with AKAP9 at the Golgi apparatus as well as, to a lesser extent, the centrosome. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity). Colocalized with podocalyxin in renal glomeruli. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab151380 has not yet been referenced specifically in any publications.