Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTDSATANGDDRDPEIELFVKAGIDGESIG NCPFSQRLFM ILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEE FLEETLTPEK YPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDD YLNTPLPEEI DANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAE MTGLWRYLKN AYARDEFTNTCAADSE
    • Molecular weight

      27 kDa including tags
    • Amino acids

      1 to 236
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Reconstituted protein solution can be stored at 4-7oC for 2-7 days. Aliquots of reconstituted samples are stable at < -20oC for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names

    • Chloride intracellular channel 5
    • Chloride intracellular channel 5A
    • Chloride intracellular channel protein 5
    • CLIC 5
    • CLIC 5B
    • CLIC5
    • CLIC5_HUMAN
    • CLIC5B
    • dJ447E21.4
    • FLJ90663
    • MST 130
    • MST130
    • MSTP 130
    • MSTP130
    see all
  • Function

    Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Required for normal formation of stereocilia in the inner ear and normal development of the organ of Corti (By similarity). Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture.
  • Tissue specificity

    Isoform 1: Expressed in renal glomeruli endothelial cells and podocytes (at protein level).
  • Sequence similarities

    Belongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • Domain

    Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Cellular localization

    Cytoplasm > cell cortex. Cytoplasm > cytoskeleton. Membrane. Associates with the cortical actin cytoskeleton. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain and Golgi apparatus. Cytoplasm > cytoskeleton > centrosome. Membrane. Colocalized with AKAP9 at the Golgi apparatus as well as, to a lesser extent, the centrosome. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity). Colocalized with podocalyxin in renal glomeruli.
  • Information by UniProt

References

ab151380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up