Overview

  • Product name

    Recombinant Human CLIP2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSG PSSSPAAAAAPEKPGPKAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGE TQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPT AEGSGSDAHSVESLTAQNLSLHSGTATPPLTSRVIPLRESVLNSSVKTGN ESGSNLSDSGSVKRGEKDLRLGDRVLVGGTKTGVVRYVGETDFAKGEWCG VELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKK TKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARK ISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLK AQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVE EESITKGDLETQTQLEHARIGELEQSLLLEKAQAERLLRELADNRLTTVA EKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAAEILRLRERLL SASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQ QATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELK AVMEGIKMEHQLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQ RHWRAQLEVQASQHRLELQEAQDQRRDAELRVHELEKLDVEYRGQAQAIE FLKEQISLAEKKMLDYERLQRAEAQGKQEVESLREKLLVAENRLQAVEAL CSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEVTALTSQTEMLR AQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQ ELLRKERSLNELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDI RGLREKLTGLDKEKSLSDQRRYSLIDPSSAPELLRLQHQLMSTEDALRDA LDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
    • Molecular weight

      142 kDa including tags
    • Amino acids

      1 to 1046

Specifications

Our Abpromise guarantee covers the use of ab132254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as CYLN2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAP GLY domain containing linker protein 2
    • CAP-Gly domain-containing linker protein 2
    • CLIP
    • CLIP 115
    • CLIP-115
    • Clip2
    • CLIP2_HUMAN
    • cytoplasmic linker 2
    • Cytoplasmic linker protein 115
    • Cytoplasmic linker protein 2
    • KIAA0291
    • MGC11333
    • restin
    • Similar to RESTIN (CYTOPLASMIC LINKER PROTEIN 170 ALPHA 2)
    • WBSCR3
    • WBSCR4
    • Williams Beuren syndrome chromosome region 3
    • Williams Beuren syndrome chromosome region 4
    • Williams-Beuren syndrome chromosomal region 3 protein
    • Williams-Beuren syndrome chromosomal region 4 protein
    • WSCR3
    • WSCR4
    see all
  • Function

    Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operates in the control of brain-specific organelle translocations.
  • Involvement in disease

    Note=CLIP2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of CLIP2 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities

    Contains 2 CAP-Gly domains.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Associated with the cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132254 stained with Coomassie Blue.

References

ab132254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up