Overview

  • Product name
    Recombinant Human CLIPR-59 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GIELDQPTGKHDGSVFGVRYFTCPPRHGVFAPASRIQRIGGSTDSPGDSV GAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRLLFCCWFPWMLRAEMQ S
    • Amino acids
      447 to 547
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as CLIP3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1500005P14Rik
    • AI844915
    • CAP GLY domain containing linker protein 3
    • CAP-Gly domain-containing linker protein 3
    • CLIP 170 related 59 kDa protein
    • CLIP-170-related 59 kDa protein
    • clip3
    • CLIP3_HUMAN
    • CLIPR 59
    • CLIPR-59
    • CLIPR59
    • Cytoplasmic linker protein 170 related 59 kDa protein
    • Cytoplasmic linker protein 170-related 59 kDa protein
    • Restin like 1
    • RSNL1
    see all
  • Function
    Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics.
  • Sequence similarities
    Contains 3 ANK repeats.
    Contains 2 CAP-Gly domains.
  • Domain
    Microtubule association is inhibited by the ANK repeats and the Golgi localization region (GoLD).
  • Cellular localization
    Cytoplasm. Golgi apparatus > Golgi stack. Localized to Golgi stacks as well as on tubulovesicular elements juxtaposed to Golgi cisternae.
  • Information by UniProt

Images

  • ab161863 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up