Description

  • Product name

    Recombinant human CLK4 protein
  • Biological activity

    The specific activity of ab204144 was determined to be12 nmol/min/mg

  • Purity

    > 90 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNR HCSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGA FGKVVECIDHGMDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSV FRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQ ICQSINFLHHNKLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDI KVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIE YYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDE HSSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEA LQHPFFDLLKKK
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      70 to 481
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab204144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    ab64311 (Myelin Basic Protein protein) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 25% Glycerol, 0.002% PMSF, 0.87% Sodium chloride, 0.004% DTT, 0.31% Glutathione, 0.79% Tris HCl, 0.003% EDTA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AI987988
    • C85119
    • CDC like kinase 4
    • CDC-like kinase 4
    • CLK4
    • CLK4_HUMAN
    • DKFZp686A20267
    • Dual specificity protein kinase CLK4
    • OTTMUSP00000005756;
    • OTTMUSP00000005757
    • OTTMUSP00000041113
    • Protein serine threonine kinase Clk4
    • RP23-9N7.1
    see all
  • Function

    Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. Phosphorylates SRSF1 and SRSF3. Required for the regulation of alternative splicing of MAPT/TAU. Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells.
  • Tissue specificity

    Expressed in liver, kidney, heart, muscle, brain and endothelial cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylates on all three types of residues.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Specific activity of ab204144.

  • SDS-PAGE analysis of ab204144. MW 73 KDa.

References

ab204144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up