Description

  • Product name

    Recombinant Human CLSTN2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLPGRLCWVPLLLALGVGSGSGGGGDSRQRRLLAAKVNKHKPWIETSYHG VITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKT SGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQV KDVNEFAPTFKEPAYKAVVTEGKIYDSILQVEAIDEDCSPQYSQICNYEI VTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTLVQ VDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSLQIVTE LQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVD SSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETI LCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQIC DKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGAC WQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSL ESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRR LKVSSKVQCFGEDVCISIPEVDAYVMVLQAIEPRITLRGTDHFWRPAAQF ESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDIL VIGGDLDPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLH HIRYRNWRPASLEARRFRIKCSELNGRYTSNEFNLEVSILHEDQVSDKEH VNHLIVQPPFLQSVHHPESRSSIQHSSVVPSIATVVIIISVCMLVFVVAM GVYRVRIAHQHFIQETEAAKESEMDWDDSALTITVNPMEKHEGPGHGEDE TEGEEEEEAEEEMSSSSGSDDSEEEEEEEGMGRGRHGQNGARQAQLEWDD STLPY
    • Amino acids

      1 to 955
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163769 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alc
    • ALC GAMMA
    • Alcadein
    • Alcadein Gamma
    • Alcagamma
    • Alzheimer's disease related cadherin like protein
    • cadherin related family member 13
    • Calsyntenin 2
    • CDHR 13
    • CDHR13
    • CLSTN 2
    • CS 2
    • CS2
    • CSTN 2
    • CSTN2
    • FLJ39113
    • FLJ39499
    • MGC119560
    see all
  • Relevance

    CLSTN2 (Alcadein gamma/Calsyntenin 2) is a member of the novel calsyntenin family of proteins that have been found to be localized in the postsynaptic membrane of excitatory central nervous system (CNS) synapses. It may play a role in postsynaptic Ca2+ signaling. Calsyntenin 2 structure is very similar to calsyntenin 1 in it's extracellular parts, but varies considerably in it's cytoplasmic segment.
  • Cellular localization

    Membrane; single-pass type I membrane protein

Images

  • ab163769 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163769 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163769.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up