Recombinant Human Clusterin alpha chain protein (His tag) (ab220542)

Description

  • Product name

    Recombinant Human Clusterin alpha chain protein (His tag)
    See all Clusterin alpha chain proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLS NLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCM KFYARVCRSGSGLVGRQLEE FLNQSSPFYFWMNGDRIDSLLENDRQQT HMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFF PKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHF HSPAFQ HPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNP SQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNW VSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVT VPVEVSRKNPKFMETVAEKALQEYRKKHREE
    • Predicted molecular weight

      51 kDa
    • Amino acids

      23 to 449
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.(NP_001822.3).

Specifications

Our Abpromise guarantee covers the use of ab220542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 40
    • AAG4
    • Aging-associated gene 4 protein
    • aging-associated protein 4
    • Apo-J
    • APOJ
    • ApoJalpha
    • ApoJbeta
    • Apolipoprotein J
    • CLI
    • CLU
    • CLUS_HUMAN
    • Clusterin
    • Clusterin alpha chain
    • Complement cytolysis inhibitor
    • Complement cytolysis inhibitor a chain
    • Complement cytolysis inhibitor b chain
    • complement lysis inhibitor
    • Complement-associated protein SP-40
    • Complement-associated protein SP-40,40
    • Ku70-binding protein 1
    • KUB1
    • MGC24903
    • NA1/NA2
    • SGP-2
    • SGP2
    • SP-40,40
    • sulfated glycoprotein 2
    • Testosterone-repressed prostate message 2
    • TRPM-2
    • TRPM2
    see all
  • Function

    Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation.
  • Tissue specificity

    Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous. Detected in brain, testis, ovary, liver and pancreas, and at lower levels in kidney, heart, spleen and lung.
  • Sequence similarities

    Belongs to the clusterin family.
  • Post-translational
    modifications

    Isoform 1 is proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen.
    Polyubiquitinated, leading to proteasomal degradation.
    Heavily N-glycosylated. About 30% of the protein mass is comprised of complex N-linked carbohydrate.
  • Cellular localization

    Nucleus. Cytoplasm. Mitochondrion membrane. Cytoplasm > cytosol. Microsome. Endoplasmic reticulum. Cytoplasmic vesicle > secretory vesicle > chromaffin granule. Isoforms lacking the N-terminal signal sequence have been shown to be cytoplasmic and/or nuclear. Secreted isoforms can retrotranslocate from the secretory compartments to the cytosol upon cellular stress. Detected in perinuclear foci that may be aggresomes containing misfolded, ubiquitinated proteins. Detected at the mitochondrion membrane upon induction of apoptosis and Secreted. Can retrotranslocate from the secretory compartments to the cytosol upon cellular stress.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220542 stained overnight with Coomassie Blue.

    The protein migrates as 39 kDa and 40 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab220542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up