Description

  • Product name

    Recombinant Human CMG1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEEVMNGYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQAT DDIIKNMSLENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEI
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • intraflagellar transport 74, Chlamydomonas, homolog of
    • Capillary morphogenesis gene 1 protein
    • Capillary morphogenesis protein 1
    • Ccdc2
    • CMG 1
    • CMG-1
    • Coiled-coil domain containing 2
    • Coiled-coil domain-containing protein 2
    • IFT74
    • IFT74_HUMAN
    • intraflagellar transport 74 homolog
    • intraflagellar transport 74 homolog (Chlamydomonas)
    • Intraflagellar transport protein 74 homolog
    see all
  • Tissue specificity

    Highly expressed in adult and fetal kidney and expressed at lower level in adult heart, placenta, lung, liver and pancreas, and in fetal heart, lung and liver. Little to no expression was detected in adult brain and skeletal muscle or in fetal brain, thymus and spleen.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasmic vesicle. Intracellular vesicular compartment.
  • Information by UniProt

Images

  • ab164211 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up