Description

  • Product name

    Recombinant Human CMKLR1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCF LGILGNGLVIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMD YHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCISVLLPVWSQNHRS VRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSS WPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRL AKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPLAT ALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRS FTKMSSMNERTSMNERETGML
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      1 to 371

Specifications

Our Abpromise guarantee covers the use of ab152289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CHEMERINR
    • Chemokine like receptor 1
    • Chemokine-like receptor 1
    • CHEMR23
    • CMKLR1
    • CML1_HUMAN
    • DEZ
    • G protein coupled receptor ChemR23
    • G protein coupled receptor DEZ
    • G-protein coupled receptor ChemR23
    • G-protein coupled receptor DEZ
    • Orphan G protein coupled receptor
    • Orphan G protein coupled receptor Dez
    • Resolvin E1 receptor
    • RVER1
    see all
  • Function

    Orphan receptor. Could be a chemotactic peptide receptor. May have a function in bone metabolism. Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2).
  • Tissue specificity

    Prominently expressed in developing osseous and cartilaginous tissue. Also found in adult parathyroid glands.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Developmental stage

    Expressed during bone development.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152289 stained with Coomassie Blue.

References

ab152289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up