Overview

  • Product name
    Recombinant Human CML66 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYNQDTALGKPREVFRLPTDLTACDNRLCASIHFSSSTWVTLSDGTGRLY VIGTGERGNSASEKWEIMFNEELGDPFIIIHSISLLNAEEHSIATLLLRI EKEELDMKGSGFYVSLEWVTISKKNQDNKKYEIIKRDILRGKSVPHYAAI EPDGNGLMIVSYKSFTFVQAGQDLEENMDEDVSEKIKEPLYYWQQTEDDL TVTIRLPEDSTKEDIQIQFLPDHINIVLKDHQFLEGKLYSSIDHESSTWI IKESNSLEISLIKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLT SEELNPHPDKEKPPCNAQELEECDIFFEESSSLCRFDGSTLKTTHVVNLG SNQYLFSVIVDPKEMPCFCLRHDVDALLWQPHSSKQDDMWEHIATFNALG YVQASKRDKKFFACAPNYSYAALCECLRRVFIYRQPAPMSTVLYNRKEGR QVGQVAKQQVASLETNDPILGFQATNERLFVLTTKNLFLIKVNTEN
    • Amino acids
      1 to 496
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as NUDCD1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4921532K09Rik
    • AA407246
    • AW260430
    • AW556235
    • Chronic myelogenous leukemia tumor antigen 66
    • CML66
    • CML66 L
    • FLJ14991
    • NudC domain containing 1
    • NudC domain-containing protein 1
    • NUDC1_HUMAN
    • nudcd1
    • OVA66
    • RGD1310624
    • Tumor antigen CML66
    see all
  • Tissue specificity
    Isoform 1 is specifically expressed in leukemias and a variety of solid tumor cell lines and is also detected in testis and heart. Isoform 2 is predominantly expressed in testis and weakly expressed in tumor cells.
  • Sequence similarities
    Contains 1 CS domain.
  • Information by UniProt

Images

  • ab164712 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up