Recombinant Human CMPK2 protein (ab165315)

Overview

  • Product name
    Recombinant Human CMPK2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GACQEAPRPHLGEFEADPRGQLWQRLWEVQDGRRLQVGCAQVVPVPEPPL HPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLVDQCPKQIQKG
    • Amino acids
      151 to 250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200004E04Rik
    • Cmpk2
    • CMPK2_HUMAN
    • Cytidine monophosphate (UMP CMP) kinase 2, mitochondrial
    • mitochondrial
    • Mitochondrial UMP CMP kinase
    • OTTHUMP00000200305
    • Thymidine monophosphate kinase 2
    • TMPK2
    • TYKi
    • UMP CMP kinase 2, mitochondrial
    • UMP CMP kinase 2, mitochondrial; cytidylate kinase 2
    • UMP CMPK2
    • UMP-CMP kinase 2
    see all
  • Function
    May participate in dUTP and dCTP synthesis in mitochondria. Is able to phosphorylate dUMP, dCMP, CMP, UMP and monophosphates of the pyrimidine nucleoside analogs ddC, dFdC, araC, BVDU and FdUrd with ATP as phosphate donor. Efficacy is highest for dUMP followed by dCMP; CMP and UMP are poor substrates. May be involved in mtDNA depletion caused by long term treatment with ddC or other pyrimidine analogs.
  • Tissue specificity
    Among all investigated tumors, leukemia cells show the most abundant expression.
  • Sequence similarities
    Belongs to the thymidylate kinase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab165315 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up