Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAG LNALLLLLYRPPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSL SLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFW PELKQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLV TSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEE EEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
    • Amino acids
      1 to 284
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700008E11Rik
    • C80758
    • fcmt
    • Gm13095
    • HSTE14
    • Icmt
    • ICMT_HUMAN
    • Isoprenylcysteine carboxylmethyltransferase
    • MGC118506
    • MGC39955
    • MGC95322
    • MST098
    • MSTP098
    • OTTMUSG00000010406
    • pcCMT
    • PCMT
    • PPMT
    • Prenylated protein carboxyl methyltransferase
    • Prenylcysteine carboxyl methyltransferase
    • Protein-S-isoprenylcysteine O-methyltransferase
    • RP23-421E12.4
    • STE14
    see all
  • Function
    Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.
  • Tissue specificity
    Ubiquitously expressed. Expressed at higher levels in the cerebellum and putamen than in other brain regions. Abundant expression seen in the Purkinje cells and pontine neurons.
  • Sequence similarities
    Belongs to the isoprenylcysteine O-methyltransferase family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab161656 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up