Description

  • Product name

    Recombinant Human CMTM3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MWPPDPDPDPDPEPAGGSRPGPAVPGLRALLPARAFLCSLKGRLLLAESG LSFITFICYVASSASAFLTAPLLEFLLALYFLFADAMQLNDKWQGLCWPM MDFLRCVTAALIYFAISITAIAKYSDGASKAAGVFGFFATIVFATDFYLI FNDVAKFLKQGDSADETTAHKTEEENSDSDSD
    • Amino acids

      1 to 182
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 9430096L06Rik
    • AI413895
    • BNAS2
    • Chemokine like factor super family 3
    • Chemokine like factor superfamily member 3
    • CKLF like MARVEL transmembrane domain containing 3
    • CKLF like MARVEL transmembrane domain containing protein 3
    • CKLFSF3
    • CMTM 3
    • FLJ31762
    • MGC51956
    see all
  • Relevance

    CMTM3 belongs to the chemokine like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The CMTM3 gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. There are two named isoforms.
  • Cellular localization

    Membrane; Multi-pass membrane protein.

Images

  • ab165204 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up