Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFV QTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQ QLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYV LTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEE AGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFM VEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVV PLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIH GIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSK RNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGST IPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFF LEMAQLH
    • Amino acids
      1 to 507
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta Ala His dipeptidase
    • Beta-Ala-His dipeptidase
    • Carnosinase 1
    • Carnosinase1
    • Carnosine dipeptidase 1
    • Carnosine dipeptidase 1 (metallopeptidase M20 family)
    • CN1
    • CNDP 1
    • CNDP dipeptidase 1
    • Cndp1
    • CNDP1_HUMAN
    • CPGL2
    • Glutamate carboxypeptidase like protein 2
    • Glutamate carboxypeptidase-like protein 2
    • HsT2308
    • MGC102737
    • MGC10825
    • MGC142072
    • OTTHUMP00000163751
    • Serum carnosinase
    • UNQ1915/PRO4380
    see all
  • Tissue specificity
    Found in serum and adult nervous central system. Absent in serum from patients with homocarnosinosis.
  • Sequence similarities
    Belongs to the peptidase M20A family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab164651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up