Description

  • Product name

    Recombinant Human CNDP1/CN1 protein
    See all CNDP1/CN1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab151865 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFR MMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGT VCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINA VSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVI SDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADL VALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRV EKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIR LVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQ YLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDG EHSQNEKINRWNYIEGTKLFAAFFLEMAQLHVDHHHHHH
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      27 to 507
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as CNDP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

General Info

  • Alternative names

    • Beta Ala His dipeptidase
    • Beta-Ala-His dipeptidase
    • Carnosinase 1
    • Carnosinase1
    • Carnosine dipeptidase 1
    • Carnosine dipeptidase 1 (metallopeptidase M20 family)
    • CN1
    • CNDP 1
    • CNDP dipeptidase 1
    • Cndp1
    • CNDP1_HUMAN
    • CPGL2
    • Glutamate carboxypeptidase like protein 2
    • Glutamate carboxypeptidase-like protein 2
    • HsT2308
    • MGC102737
    • MGC10825
    • MGC142072
    • OTTHUMP00000163751
    • Serum carnosinase
    • UNQ1915/PRO4380
    see all
  • Tissue specificity

    Found in serum and adult nervous central system. Absent in serum from patients with homocarnosinosis.
  • Sequence similarities

    Belongs to the peptidase M20A family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up