Overview

  • Product name

    Recombinant Human CNG3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGI AMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPD RFRGAELKEVSSQESNAQANVGSQEPADRGRRKKTKKKDAIVVDPSSNLY YRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDV LVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKVGT NYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNA CIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWSTLTLTTIGE TPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKID SIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEI AINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKE MYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANI RSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQ VKGGGDKPLADGEVPGDATKTEDKQQ
    • Molecular weight

      103 kDa including tags
    • Amino acids

      1 to 676

Specifications

Our Abpromise guarantee covers the use of ab132987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACHM2
    • CCNC1
    • CCNCa
    • CCNCalpha
    • CNCG3
    • CNG 3
    • CNG channel alpha 3
    • CNG channel alpha-3
    • CNG-3
    • CNG3
    • CNGA3
    • Cnga3 cyclic nucleotide gated channel alpha 3
    • CNGA3_HUMAN
    • Cone photoreceptor cGMP gated channel
    • Cone photoreceptor cGMP gated channel alpha subunit
    • Cone photoreceptor cGMP gated channel subunit alpha
    • Cone photoreceptor cGMP-gated channel subunit alpha
    • Cyclic nucleotide gated cation channel alpha 3
    • Cyclic nucleotide gated channel alpha 3
    • Cyclic nucleotide gated channel olfactory 3
    • Cyclic nucleotide gated channel rod photoreceptor subunit alpha
    • Cyclic nucleotide-gated cation channel alpha-3
    • Cyclic nucleotide-gated channel alpha-3
    • OTTHUMP00000161120
    see all
  • Function

    Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGB3 (By similarity). Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones.
  • Tissue specificity

    Prominently expressed in retina.
  • Involvement in disease

    Defects in CNGA3 are the cause of achromatopsia type 2 (ACHM2) [MIM:216900]; also known as total colorblindness or rod monochromacy (RMCH2). ACHM2 is an autosomal recessive condition characterized by day blindness and photophobia. In ACHM2 patients the cones are defective and the subjects see better at night.
  • Sequence similarities

    Belongs to the cyclic nucleotide-gated cation channel (TC 1.A.1.5) family. CNGA3 subfamily.
    Contains 1 cyclic nucleotide-binding domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132987 stained with Coomassie Blue.

References

ab132987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up