Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNIL PTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY
    • Amino acids
      366 to 464
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CNK homolog protein 3
    • CNK3
    • CNKSR family member 3
    • Connector enhancer of kinase suppressor of ras 3
    • Connector enhancer of KSR 3
    • MAGI1
    • Maguin like protein
    • Membrane associated guanylate kinase interacting protein like 1
    • Membrane associated guanylate kinase, WW and PDZ domain containing 1
    • RP11 486M3 1
    • RP11 486M3.1
    see all
  • Relevance
    CNKSR3 belongs to the CNKSR family. It contains 1 CRIC domain, 1 DUF1170 domain, 1 PDZ (DHR) domain and 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Cell Membrane and Cytoplasmic

Images

  • ab165674 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up