Description

  • Product name

    Recombinant Human CNOT8 protein
    See all CNOT8 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab204216 was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFPAALVENSQVICEVWASNLEE EMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLL KIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQ FQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDS RLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIG RQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNE DVDSAQEKMSILAIINNMQQ
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      2 to 292
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      NP_004770.4. Constructed with 29 aa N-terminal T7 / His / TEV cleavage site Tag and expressed in E.coli as inclusion bodies.

Specifications

Our Abpromise guarantee covers the use of ab204216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.87% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • CAF 1
    • CAF 2
    • CAF1
    • CAF1 like protein
    • CAF1-like protein
    • CAF2
    • CALIF
    • CALIFp
    • CCR4 associated factor 8
    • CCR4 NOT transcription complex subunit 8
    • CCR4-associated factor 8
    • CCR4-NOT transcription complex subunit 8
    • CNOT 8
    • Cnot8
    • CNOT8_HUMAN
    • hCAF1
    • PGK promoter directed over production
    • POP 2
    • POP2
    see all
  • Function

    Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex.
  • Sequence similarities

    Belongs to the CAF1 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab204216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up