Description

  • Product name

    Recombinant Human CNPase protein
    See all CNPase proteins and peptides
  • Expression system

    Escherichia coli
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLF ILRGLPGSGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRL DEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQYQYQVVLVEPKTA WRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLR KAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCT TKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELS EQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILR QEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKP VPTQGSRKGGALQSCTII
    • Amino acids

      4 to 421

Specifications

Our Abpromise guarantee covers the use of ab92238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 43 µl distilled water.

General Info

  • Alternative names

    • 2''
    • 2'3' cyclic nucleotide 3' phosphodiesterase
    • 3''-cyclic-nucleotide 3''-phosphodiesterase
    • CN37_HUMAN
    • CNP
    • CNP 1
    • CNP1
    • CNPase
    see all
  • Sequence similarities

    Belongs to the cyclic nucleotide phosphodiesterase family.
  • Cellular localization

    Membrane. Melanosome. Firmly bound to membrane structures of brain white matter. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab92238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up