Description

  • Product name

    Recombinant human CNTFR protein
    See all CNTFR proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.
    Immobilized Human CNTF Receptor alpha at 10 μg/ml (100 μl/well) can bind biotinylated Human CNTF with a linear ranger of 3.2 - 100 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGS QLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYP KGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLF STIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRL EVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYA GKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTST TSSLAPPPTTKICDPGELGSGGGP
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      23 to 346
    • Tags

      His tag C-Terminus
    • Additional sequence information

      AAH01492.

Specifications

Our Abpromise guarantee covers the use of ab191640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.4
    Constituents: 5% Trehalose, 95% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Ciliary neurotrophic factor receptor
    • Ciliary neurotrophic factor receptor alpha
    • Ciliary neurotrophic factor receptor subunit alpha
    • CNTF Receptor alpha
    • CNTF receptor subunit alpha
    • CNTFR
    • CNTFR Alpha
    • CNTFR-alpha
    • CNTFR_HUMAN
    see all
  • Function

    Binds to CNTF. The alpha subunit provides the receptor specificity.
  • Tissue specificity

    Nervous system and skeletal muscle.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Human CNTF R alpha (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • SDS-PAGE analysis of reduced ab191640 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 45-48 kDa due to glycosylation.

References

ab191640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up