Overview

  • Product name

    Recombinant Human CNTP5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      DFVVVLLCKNGSLQVRYHLNKEETHVFTIDADNFANRRMHHLKINREGRE LTIQMDQQLRLSYNFSPEVEFRVIRSLTLGKVTENLGLDSEVAKANAMG
    • Amino acids

      1062 to 1160
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cell recognition molecule Caspr5
    • CNTNAP5
    • CNTP5_HUMAN
    • Contactin-associated protein-like 5
  • Function

    May play a role in the correct development and proper functioning of the peripheral and central nervous system and be involved in cell adhesion and intercellular communication.
  • Sequence similarities

    Belongs to the neurexin family.
    Contains 2 EGF-like domains.
    Contains 1 F5/8 type C domain.
    Contains 1 fibrinogen C-terminal domain.
    Contains 4 laminin G-like domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab165317 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up