Description

  • Product name

    Recombinant Human COASY protein
  • Purity

    > 90 % SDS-PAGE.
    This protein was expressed in E. coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFMAINRFRLENDLEELALYQIQLLKDLRHTENEEDK VSSSSFRQRMLGNLLRPPYERPELPTCLYVIGLTGISGSGKSSIAQRLKG LGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGIINRKVLGSRV FGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQ NLVHEVWTAVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHV VLSTLWEPHITQRQVEKAWALLQKRIPKTHQALD
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      296 to 564
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      Constructed with 15 N-terminal T7 tag.

Specifications

Our Abpromise guarantee covers the use of ab211940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • Bifunctional coenzyme A synthase
    • Bifunctional phosphopantetheine adenylyl transferase/dephospho CoA kinase
    • CoA synthase
    • COASY
    • COASY_HUMAN
    • Coenzyme A synthase
    • Dephospho-CoA kinase
    • Dephospho-CoA pyrophosphorylase
    • Dephosphocoenzyme A kinase
    • DPCK
    • DPCOAK
    • NBP
    • Nucleotide binding protein
    • Pantetheine-phosphate adenylyltransferase
    • Phosphopantetheine adenylyltransferase / dephosphocoenzyme A kinase
    • pOV 2
    • POV-2
    • POV2
    • PPAT
    • UKR1
    see all
  • Function

    Bifunctional enzyme that catalyzes the fourth and fifth sequential steps of CoA biosynthetic pathway. The fourth reaction is catalyzed by the phosphopantetheine adenylyltransferase, coded by the coaD domain; the fifth reaction is catalyzed by the dephospho-CoA kinase, coded by the coaE domain. May act as a point of CoA biosynthesis regulation.
  • Tissue specificity

    Expressed in all tissues examined including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. Lowest expression in peripheral blood leukocytes and highest in kidney and liver. Isoform 2 is expressed mainly in the brain.
  • Pathway

    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 4/5.
    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 5/5.
  • Sequence similarities

    In the central section; belongs to the eukaryotic coaD family.
    Contains 1 DPCK (dephospho-CoA kinase) domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab211940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up