Description

  • Product name

    Recombinant Human COBP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MYFKRAARAFPVLLTGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEK SLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLE TTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGL INEATRQVALADAILINKTDLVPEEDVKKLRTTIRSINGLGQILETQRSR VDLSNVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFEVPGNAK EEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHE LYDLEETPVSWKDDTERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTT RFQEDQVCT
    • Amino acids

      1 to 359
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as CBWD1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cbwd1
    • CBWD1_HUMAN
    • Cobalamin synthase W domain-containing protein 1
    • Cobalamin synthetase W domain containing protein 1
    • COBP
    • COBW domain containing 1
    • COBW domain-containing protein 1
    • COBW like protein
    • NPC-A-6
    • NPC-A-6 COBW domain-containing protein 1
    see all
  • Tissue specificity

    Ubiquitously expressed. Up-regulated in cultured astrocytes treated with dopamine.
  • Sequence similarities

    Belongs to the CobW family.
    Contains 1 cobW C-terminal domain.
  • Information by UniProt

Images

  • ab163262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up