Description

  • Product name

    Recombinant Human Codanin-1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSL HQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS
    • Amino acids

      1130 to 1227
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CDAN1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDA1
    • CDAI
    • CDAN1
    • CDAN1_HUMAN
    • Codanin
    • Codanin-1
    • Codanin1
    • PRO1295
    see all
  • Function

    Might be involved in nuclear membrane integrity.
  • Tissue specificity

    Ubiquitously expressed. Isoform 3 is not found in erythroid cells.
  • Involvement in disease

    Defects in CDAN1 are the cause of congenital dyserythropoietic anemia type 1 (CDA1) [MIM:224120]. An autosomal recessive blood disorder characterized by morphological abnormalities of erythroblasts, ineffective erythropoiesis, macrocytic anemia and secondary hemochromatosis. It is occasionally associated with bone abnormalities, especially of the hands and feet (acrodysostosis), nail hypoplasia, and scoliosis. Ultrastructural features include internuclear chromatin bridges connecting some nearly completely separated erythroblasts and an abnormal appearance (spongy or Swiss-cheese appearance) of the heterochromatin in a high proportion of the erythroblasts.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab165526 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up