Overview

  • Product name

    Recombinant Human COG3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAEAALLLLPEAAAERDAREKLALWDRRPDTTAPLTDRQTDSVLELKAAA ENLPVPAELPIEDLCSLTSQSLPIELTSVVPESTEDILLKGFTSLGMEEE RIETAQQFFSWFAKLQTQMDQDEGTKYRQMRDYLSGFQEQCDAILNDVNS ALQHLESLQKQYLFVSNKTGTLHEACEQLLKEQSELVDLAENIQQKLSYF NELETINTKLNSPTLSVNSDGFIPMLAKLDDCITYISSHPNFKDYPIYLL KFKQCLSKALHLMKTYTVNTLQTLTSQLLKRDPSSVPNADNAFTLFYVKF RAAAPKVRTLIEQIELRSEKIPEYQQLLNDIHQCYLDQRELLLGPSIACT VAELTSQNNRDHCALVRSGCAFMVHVCQDEHQLYNEFFTKPTSKLDELLE KLCVSLYDVFRPLIIHVIHLETLSELCGILKNEVLEDHVQNNAEQLGAFA AGVKQMLEDVQERLVYRTHIYIQTDITGYKPAPGDLAYPDKLVMMEQIAQ SLKDEQKKVPSEASFSDVHLEEGESNSLTKSGSTESLNPRPQTTISPADL HGMWYPTVRRTLVCLSKLYRCIDRAVFQGLSQEALSACIQSLLGASESIS KNKTQIDGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKIL NPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQF IQQQTKLFVEQLEEFMTKVSALKTMASQGGPKYTLSQQPWAQPAKVSDLA ATAYKTIKTKLPVTLRSMSLYLSNKDTEFILFKPVRNNIQQVFQKFHALL KEEFSPEDIQIIACPSMEQLSLLLSVSK
    • Amino acids

      1 to 828
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COG complex subunit 3
    • Cog3
    • COG3_HUMAN
    • Component of golgi transport complex 3
    • Component of oligomeric Golgi complex 3
    • Conserved oligomeric Golgi complex subunit 3
    • OTTHUMP00000018352
    • p94
    • SEC34
    • SEC34 S. cerevisiae homolog of
    • SEC34, S. cerevisiae, homolog of
    • Tethering factor SEC34
    • Vesicle docking protein SEC34 homolog
    • Vesicle-docking protein SEC34 homolog
    see all
  • Function

    Involved in ER-Golgi transport.
  • Tissue specificity

    Widely expressed with highest levels in pancreas and testis and lowest levels in lung.
  • Sequence similarities

    Belongs to the COG3 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Associated with the peripheral membrane of cis/medial cisternae.
  • Information by UniProt

Images

  • ab164405 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up