Description

  • Product name

    Recombinant Human COG7 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQE ANHAVEETSHQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQD TSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVI SAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQA VDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQL TGLYDALLGAWHTQIQWATQVFQKPHEVVMVLLIQTLGALMPSLPSCLSN GVERAGPEQELTRLLEFYDATAHFAKGLEMALLPHLHEHNLVKVTELVDA VYDPYKPYQLKYGDMEESNLLIQMSAVPLEHGEVIDCVQELSHSVNKLFG LASAAVDRCVRFTNGLGTCGLLSALKSLFAKYVSDFTSTLQSIRKKCKLD HIPPNSLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKY LSDSCSPRSLAGFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEIL YTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKM DSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDS ALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCDAILQI PELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQV SKGLPRRLATTVATMRSVNY
    • Amino acids

      1 to 770
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDG2E
    • COG complex subunit 7
    • cog7
    • COG7_HUMAN
    • Component of oligomeric Golgi complex 7
    • Conserved oligomeric Golgi complex component 7
    • Conserved oligomeric Golgi complex subunit 7
    see all
  • Function

    Required for normal Golgi function.
  • Involvement in disease

    Defects in COG7 are the cause of congenital disorder of glycosylation type 2E (CDG2E) [MIM:608779]. CDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
  • Sequence similarities

    Belongs to the COG7 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab164887 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up