Description

  • Product name

    Recombinant Human COG8/DOR1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFC TVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNI
    • Amino acids

      450 to 545
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as COG8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COG complex subunit 8
    • Component of oligomeric golgi complex 8
    • Conserved oligomeric Golgi complex component 8 dependent on RIC1
    • DOR1
  • Relevance

    COG8 is a component of the conserved oligomeric Golgi (COG) complex. This is a multiprotein complex that plays a structural role in the Golgi apparatus and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins and whose symptoms include severe psychomotor retardation, failure to thrive, seizures and dairy and wheat product intolerance. It is required for normal Golgi function.
  • Cellular localization

    Golgi apparatus; Peripheral membrane protein.

Images

  • ab164579 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up