Description

  • Product name

    Recombinant Human Coilin protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGK FDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEP
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      477 to 575

Specifications

Our Abpromise guarantee covers the use of ab112377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab112377 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names

    • CLN 80
    • CLN80
    • COIL
    • COIL_HUMAN
    • Coilin
    • Coilin p80
    • p80
    • P80 coilin
    see all
  • Function

    Is a component of the nuclear coiled bodies (CBS) which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBS disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin.
  • Tissue specificity

    Found in all the cell types examined.
  • Sequence similarities

    Belongs to the coilin family.
  • Cellular localization

    Nucleus. Nuclear coiled body located in the interchromatin space between the nucleolus and the nucleus.
  • Information by UniProt

Images

  • ab112377 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab112377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up