Overview

  • Product name

    Recombinant Human COL1A2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNS RFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEF FVDIGPVCFK
    • Amino acids

      1257 to 1366
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha 2 collagen type I
    • Alpha 2 type I collagen
    • Alpha 2 type I procollagen
    • Alpha 2(I) collagen
    • Alpha 2(I) procollagen
    • Alpha-2 type I collagen
    • CO1A2_HUMAN
    • COL1A2
    • Collagen alpha 2(I) chain
    • Collagen alpha-2(I) chain
    • Collagen I alpha 2 polypeptide
    • Collagen of skin tendon and bone alpha 2 chain
    • Collagen type I alpha 2
    • OI4
    • Osteogenesis imperfecta type IV
    • Type I procollagen
    see all
  • Function

    Type I collagen is a member of group I collagen (fibrillar forming collagen).
  • Tissue specificity

    Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.
  • Involvement in disease

    Ehlers-Danlos syndrome 7B
    Osteogenesis imperfecta 1
    Osteogenesis imperfecta 2
    Ehlers-Danlos syndrome, autosomal recessive, cardiac valvular form
    Osteogenesis imperfecta 3
    Osteogenesis imperfecta 4
    A chromosomal aberration involving COL1A2 may be a cause of lipoblastomas, which are benign tumors resulting from transformation of adipocytes, usually diagnosed in children. Translocation t(7;8)(p22;q13) with PLAG1.
  • Sequence similarities

    Belongs to the fibrillar collagen family.
    Contains 1 fibrillar collagen NC1 domain.
  • Domain

    The C-terminal propeptide, also known as COLFI domain, have crucial roles in tissue growth and repair by controlling both the intracellular assembly of procollagen molecules and the extracellular assembly of collagen fibrils. It binds a calcium ion which is essential for its function.
  • Post-translational
    modifications

    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab158153 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up