Description

  • Product name

    Recombinant Human COL21A1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IPVAARDERGFDILLGLDVNKKVKKRIQLSPKKIKGYEVTSKVDLSELTS NVFPEGLPPSYVFVSTQRFKVKKIWDLWRILTIDGRPQIAVTLNGVDKIL
    • Amino acids

      221 to 320
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha 1 chain like collagen
    • Alpha 1 type XXI collage
    • COL20A1
    • COL21A1 protein
    • COLA1L
    • Collagen alpha 1 chain like
    • Collagen alpha 1(XXI) chain
    • Collagen type XXI alpha 1
    • Collagen type XXI alpha 1 Fragment
    • dJ682J15.1
    • dJ708F5.1
    • FP633
    • Uncharacterized protein COL21A1
    see all
  • Relevance

    This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined. [Entrez Gene]
  • Cellular localization

    Secreted, extracellular space, extracellular matrix. Cytoplasm. Note: Found in the extracellular matrix component of blood vessel walls and in the cytoplasm of cultured human aortic smooth muscle.

Images

  • ab164343 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up