Overview

  • Product name
    Recombinant Human COL6A5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDVVFLIDNSRNIAKDEFKAVKALVSSVIDNFNIASDPLISDSGDRIALL SYSPWESSRRKMGTVKTEFDFITYDNQLLMKNHIQTSFQQLNGEATIGRA LLWTTENLFPETPYLRKHKVIFVVSAGENYERKEFVKMMALRAKCQGYVI FVISLGSTRKDDMEELASYPLDQHLIQLGRIHKPDLNYIAKFLKPFLYSV RRGFNQYPPPMLEDACRLINLGGENIQNDGFQFVTELQEDFLGGNGFIGQ ELNSGRESPFVKTEDNGSDYLVYLPSQMFEPQKLMINYEKDQKSAEIASL TSGHENYGRKEEPDHTYEPGDVSLQEYYMDVAFLIDASQRVGSDEFKEVK AFITSVLDYFHIAPTPLTSTLGDRVAVLSYSPPGYMPNTEECPVYLEFDL VTYNSIHQMKHHLQDSQQLNGDVFIGHALQWTIDNVFVGTPNLRKNKVIF VISAGETNSLDKDVLRNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHP LDHHLVQLGRTHKPDWNYIIKFVKPFVHLIRRAINKYPTEDMKATCVNMT SPNPENGGTENTVLW
    • Amino acids
      1 to 565
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CO6A5_HUMAN
    • COL29A1
    • Col6a5
    • Collagen alpha-1(XXIX) chain
    • Collagen alpha-5(VI) chain
    • Collagen, type VI, alpha 5
    • Collagen, type XXIX, alpha-1
    • EG665033
    • FLJ35880
    • Gm7455
    • von Willebrand factor A domain-containing protein 4
    • VWA4
    see all
  • Function
    Collagen VI acts as a cell-binding protein.
  • Tissue specificity
    Expressed in skin, followed by lung, small intestine, colon and testis. In skin, it is expressed in the epidermis with strongest staining in suprabasal viable layers. In ATOD patients, it is absent in the most differentiated upper spinous and granular layers (at protein level).
  • Involvement in disease
    Note=Patients affected by atopic dermatitis display an abnormal distribution of COL29A1 mRNA and protein in skin suggesting that COL29A1 may be involved in the pathogenesis of the disease.
  • Sequence similarities
    Belongs to the type VI collagen family.
    Contains 10 VWFA domains.
  • Post-translational
    modifications
    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix. Deposed in the extracellular matrix of skeletal muscle.
  • Information by UniProt

Images

  • ab166058 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up