Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIG QDDLPGFDLISQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTR NLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVGIKINGQT QSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNR IESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRE TCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP PGPPGPAGEPGKPGAPGKPGTPGADTSP
    • Amino acids
      1 to 328
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha 1 IX collagen chain
    • Alpha 1 type IX collagen
    • alpha-1(IX) collagen chain
    • Cartilage specific short collagen
    • Collagen alpha 1 IX chain
    • Collagen alpha-1(IX) chain
    • Collagen cartilage-specific short alpha collagen
    • Collagen cartilage-specific short alpha-1(IX) collagen chain
    • Collagen IX alpha 1 polypeptide
    • Collagen IX, alpha 1 polypeptide
    • collagen, type IX alpha
    • collagen, type IX, alpha 1
    • DJ149L1.1.2
    • EDM 6
    • EDM6
    • FLJ40263
    • MED
    • STL 4
    • STL4
    see all
  • Cellular localization
    Secreted, extracellular space, extracellular matrix

Images

  • ab158165 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up