Description

  • Product name

    Recombinant Human COL9A1 protein
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab194045 was determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRA IQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGST LKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLS SLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKL ADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGE QGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPG ADTSPVDHHHHHH
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      24 to 328
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 24 to 328 of isoform 3. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • alpha 1 IX collagen chain
    • Alpha 1 type IX collagen
    • alpha-1(IX) collagen chain
    • Cartilage specific short collagen
    • collagen
    • Collagen alpha 1 IX chain
    • Collagen alpha-1(IX) chain
    • Collagen cartilage-specific short alpha collagen
    • Collagen cartilage-specific short alpha-1(IX) collagen chain
    • Collagen IX alpha 1 polypeptide
    • Collagen IX, alpha 1 polypeptide
    • collagen, type IX alpha
    • collagen, type IX, alpha 1
    • DJ149L1.1.2
    • EDM 6
    • EDM6
    • FLJ40263
    • MED
    • STL 4
    • STL4
    see all
  • Cellular localization

    Secreted, extracellular space, extracellular matrix

References

ab194045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up