Recombinant Human COL9A3 protein (ab158167)

Overview

  • Product name
    Recombinant Human COL9A3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGE KGPNGLPGL
    • Amino acids
      280 to 338
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha 3 type IX collagen
    • collagen alpha 3 IX chain
    • collagen alpha 3(IX) chain
    • collagen IX alpha 3 polypeptide
    • collagen IX alpha-3 polypeptide
    • collagen type IX alpha 3
    • collagen type IX proteoglycan
    • DJ885L7.4.1
    • EDM3
    • IDD
    • MED
    see all
  • Relevance
    Belongs to the fibril-associated collagens with interrupted helices (FACIT) family. collagen,type IX,alpha 3,fibril associated collagen with interrupted triple helices(FACIT), expressed in cartilage. Structural component of hyaline cartilage and vitreous of the eye. Defects in COL9A3 are the cause of multiple epiphyseal dysplasia type 3 (EDM3), also known as multiple epiphyseal dysplasia with myopathy. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix

Images

  • ab158167 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up