Description

  • Product name

    Recombinant Human Collagen IV alpha 6 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GEKSYGKPCGGQDCSGSCQCFPEKGARHNLQLLNDMAGRLYHFSEVLPNL F
    • Amino acids

      23 to 73
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COL4A6
    • Collagen Alpha 6(IV)
    • Collagen alpha 6(IV) chain
    • Collagen IV alpha 6 polypeptide
    • Collagen of basement membrane alpha 6
    • Collagen type IV alpha 6
    • dJ889N15.4
    • MGC88184
    • Type IV alpha 6 collagen
    see all
  • Relevance

    Collagen IV alpha 6 is one of six subunits of type IV collagen. Type IV collagen is the major structural component of glomerular basement membranes (GBM) together with laminins, proteoglycans and entactin/nidogen. It is a triple-helical molecule composed of 3 alpha chains.
  • Cellular localization

    Secreted

Images

  • ab158158 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up