Description

  • Product name

    Recombinant Human COMP/Cartilage oligomeric matrix protein
    See all COMP/Cartilage oligomeric matrix protein proteins and peptides
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HVDYKDDDDKPAGQGQSPLGSDLGPQMLRELQETNAALQDVRE LLRQQ VREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGV ACI QTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFR C EACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINT RGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDG S RSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPN SGQ EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWG DACDN CRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNS DQKDSDG DGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGH QDSRDNCPT VPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPN PGQEDADRDGV GDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTV VLDPEGDAQIDPN WVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGT FHVNTVTDDDYAGFI FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEP GIQLKAVKSSTGPGEQL RNALWHTGDTESQVRLLWKDPRNVGWKDKKS YRWFLQHRPQVGYIRVRFY EGPELVADSNVVLDTTMRGGRLGVFCFSQ ENIIWANLRYRCNDTIPEDYE THQLRQA
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      21 to 757
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Additional notes

    Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
    Store lyophilized protein at -20°C. Lyophilized protein remains stable until the expiry date when stored at -20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.

     This product was previously labelled as COMP

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.242% Tris, 0.29% Sodium chloride

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names

    • Cartilage oligomeric matrix protein
    • cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple)
    • Cartilage oligomeric matrix protein precursor
    • COMP
    • COMP_HUMAN
    • EDM 1
    • EDM1
    • EPD 1
    • EPD1
    • Epiphyseal dysplasia 1
    • Epiphyseal dysplasia 1 multiple
    • Epiphyseal dysplasia multiple 1
    • MED
    • MGC13181
    • MGC149768
    • PSACH
    • Pseudoachondroplasia
    • pseudoachondroplasia (epiphyseal dysplasia 1, multiple)
    • THBS 5
    • THBS5
    • Thrombospondin 5
    • Thrombospondin-5
    • Thrombospondin5
    • TSP5
    see all
  • Function

    May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7.
  • Tissue specificity

    Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect.
  • Involvement in disease

    Defects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1) [MIM:132400]. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
    Defects in COMP are the cause of pseudoachondroplasia (PSACH) [MIM:177170]. PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood.
  • Sequence similarities

    Belongs to the thrombospondin family.
    Contains 4 EGF-like domains.
    Contains 1 TSP C-terminal (TSPC) domain.
    Contains 8 TSP type-3 repeats.
  • Developmental stage

    Present during the earliest stages of limb maturation and is later found in regions where the joints develop.
  • Domain

    The cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.
    The TSP C-terminal domain mediates interaction with FN1 and ACAN.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 14% SDS-PAGE showing ab104358 at approximately 82.4kDa:
    Lane 1: M.W. marker – 21, 31, 45, 66, 97 kDa.
    Lane 2: reduced and boiled sample, 5μg/lane.
    Lane 3: non-reduced and non-boiled sample, 5μg/lane.
  • Anti-COMP/Cartilage oligomeric matrix protein antibody (ab42225) at 1/1000 dilution + Recombinant Human COMP/Cartilage oligomeric matrix protein (ab104358) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 2 minutes

References

ab104358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up