Bioactive grade

Recombinant human COMP/Cartilage oligomeric matrix protein (Active) (ab174082)

Description

  • Product name

    Recombinant human COMP/Cartilage oligomeric matrix protein (Active)
    See all COMP/Cartilage oligomeric matrix protein proteins and peptides
  • Biological activity

    Measured by its ability to induce adhesion of ATDC5 mouse chondrogenic cells, when COMP / Thrombospondin-5 immobilized at 1 µg/well.

    More than 45% of ATDC-5 cell adhesion will be induced.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAF AKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASG CQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDT DLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDG VPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDA CDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDD DDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVC PENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGL AVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQT YWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKD PRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
    • Predicted molecular weight

      82 kDa including tags
    • Amino acids

      21 to 757
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein. (AAI25093)

Specifications

Our Abpromise guarantee covers the use of ab174082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as COMP

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names

    • Cartilage oligomeric matrix protein
    • cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple)
    • Cartilage oligomeric matrix protein precursor
    • COMP
    • COMP_HUMAN
    • EDM 1
    • EDM1
    • EPD 1
    • EPD1
    • Epiphyseal dysplasia 1
    • Epiphyseal dysplasia 1 multiple
    • Epiphyseal dysplasia multiple 1
    • MED
    • MGC13181
    • MGC149768
    • PSACH
    • Pseudoachondroplasia
    • pseudoachondroplasia (epiphyseal dysplasia 1, multiple)
    • THBS 5
    • THBS5
    • Thrombospondin 5
    • Thrombospondin-5
    • Thrombospondin5
    • TSP5
    see all
  • Function

    May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7.
  • Tissue specificity

    Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect.
  • Involvement in disease

    Defects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1) [MIM:132400]. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
    Defects in COMP are the cause of pseudoachondroplasia (PSACH) [MIM:177170]. PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood.
  • Sequence similarities

    Belongs to the thrombospondin family.
    Contains 4 EGF-like domains.
    Contains 1 TSP C-terminal (TSPC) domain.
    Contains 8 TSP type-3 repeats.
  • Developmental stage

    Present during the earliest stages of limb maturation and is later found in regions where the joints develop.
  • Domain

    The cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.
    The TSP C-terminal domain mediates interaction with FN1 and ACAN.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab174082 purity. Note: DTT-reduced Protein migrates as 110-130 kDa due to glycosylation.

References

ab174082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up