Recombinant Human Complement factor B protein (denatured) (ab174401)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSKIVLDPSGSMNIYLVLDGSDSIGASNF TGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVT KQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIIL MTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQ VNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRK GTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHS IKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKL KYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEE EKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGV SPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPA HARDFHINLFQVLPWLKEKLQDEDLGFL
    • Molecular weight
      59 kDa including tags
    • Amino acids
      260 to 764
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Complement factor B Bb fragment. NCBI Accession No. NP_001701.

Specifications

Our Abpromise guarantee covers the use of ab174401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • C3/C5 convertase
    • Complement factor B
    • Glycine-rich beta glycoprotein
    • PBF2
    • Properdin factor B
    see all
  • Relevance
    Factor B which is part of the alternate pathway of the complement system is cleaved by factor D into 2 fragments: Ba and Bb. Bb, a serine protease, then combines with complement factor 3b to generate the C3 or C5 convertase. It has also been implicated in proliferation and differentiation of preactivated B-lymphocytes, rapid spreading of peripheral blood monocytes, stimulation of lymphocyte blastogenesis and lysis of erythrocytes. Ba inhibits the proliferation of preactivated B-lymphocytes.
  • Cellular localization
    Plasma membrane and Secreted

Images

  • 15% SDS-PAGE analysis of ab174401 (3μg).

References

ab174401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up