Description

  • Product name

    Recombinant Human Connexin 45/GJA7/Cx45 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DQIQYTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQ ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI
    • Amino acids

      297 to 396
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Connexin 45 / GJA7. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Connexin 45
    • Connexin 45 / GJA7
    • Connexin-45
    • Connexin45
    • CX 31.9
    • CX 45
    • CX31.9
    • Cx45
    • CXG1_HUMAN
    • DKFZp686P0738
    • Gap junction alpha 7 protein
    • Gap junction alpha-7 protein
    • Gap junction gamma 1 protein
    • Gap junction gamma-1 protein
    • Gap junction protein alpha 7
    • Gap junction protein alpha 7 45kDa
    • Gap junction protein, gamma 1, 45kDa
    • GJA 7
    • GJA7
    • GJC1
    • GJD3
    see all
  • Function

    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Sequence similarities

    Belongs to the connexin family. Gamma-type subfamily.
  • Cellular localization

    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Images

  • ab153040 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up