Description

  • Product name

    Recombinant Human COPS3/CSN3 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALD VQEHSLGVLAVLFVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTF AGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTSIHADLCQLCL LAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFER ALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVG RFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLS SLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFAS INQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVN PQFVQKSMGSQEDDSGNKPSSYS
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      1 to 423

Specifications

Our Abpromise guarantee covers the use of ab132040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.

     This product was previously labelled as COPS3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Constitutive photomorphogenic homolog subunit 3
    • COP 9 (constitutive photomorphogenic) subunit 3
    • COP 9 complex homolog subunit 3
    • COP 9 complex S3
    • COP 9 complex subunit 3
    • COP 9 constitutive photomorphogenic homolog subunit 3
    • COP 9 homolog
    • COP 9 signalosome complex subunit 3
    • COP 9 signalosome subunit 3
    • COP 9 subunit 3
    • COP9 (constitutive photomorphogenic) subunit 3
    • COP9 complex homolog subunit 3
    • COP9 complex S3
    • COP9 complex subunit 3
    • COP9 constitutive photomorphogenic homolog subunit 3
    • COP9 homolog
    • COP9 signalosome complex subunit 3
    • COP9 signalosome subunit 3
    • COP9 subunit 3
    • COPS 3
    • cops3
    • CSN 3
    • CSN3
    • CSN3_HUMAN
    • JAB 1 containing signalosome subunit 3
    • JAB1 containing signalosome subunit 3
    • JAB1-containing signalosome subunit 3
    • SGN 3
    • SGN3
    • Signalosome subunit 3
    see all
  • Function

    Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.
  • Tissue specificity

    Widely expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the CSN3 family.
    Contains 1 PCI domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132040 stained with Coomassie Blue.

References

ab132040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up