Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILN ISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIII DKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPL FLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGV DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV PFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCN TMNQFVNKFNVLYDRQGIGRRMRGLFF
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 327

Specifications

Our Abpromise guarantee covers the use of ab132862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COP9 (constitutive photomorphogenic), subunit 6; COP9 complex S6
    • COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
    • COP9 signalosome complex subunit 6
    • COP9 signalosome subunit 6
    • COP9 subunit 6 (MOV34 homolog, 34 kD)
    • cops6
    • CSN6
    • CSN6_HUMAN
    • H_NH0506M12.12
    • hVIP
    • JAB1 containing signalosome subunit 6
    • JAB1-containing signalosome subunit 6
    • MOV34 homolog
    • MOV34 homolog, 34 kD
    • MOV34-34KD
    • OTTMUSP00000025868
    • Sgn3
    • SGN6
    • Signalosome subunit 6
    • VIP/MOV34
    • Vpr interacting protein
    • Vpr-interacting protein
    see all
  • Function

    Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Has some glucocorticoid receptor-responsive activity.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the peptidase M67A family. CSN6 subfamily.
    Contains 1 MPN (JAB/Mov34) domain.
  • Cellular localization

    Nucleus. Cytoplasm. The interaction with HIV-1 Vpr protein possibly leads its translocation to a perinuclear region.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132862 stained with Coomassie Blue.

References

ab132862 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up