Description

  • Product name

    Recombinant Human COPZ1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab107148 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEALILEPSLYTVKAILILDNDGDRLFAKY YDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVI GSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVD GGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 177
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • CGI-120
    • Coatomer protein complex, subunit zeta 1
    • Coatomer subunit zeta-1
    • COPZ
    • HSPC181
    • Zeta-1 COP
    • Zeta-1-coat protein
    • Zeta-COP
    • Zeta1-COP
    see all
  • Relevance

    The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle; COPI-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side.

Images

  • 15% SDS-PAGE showing ab107148 (3µg).

References

ab107148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up