Description

  • Product name

    Recombinant Human CoREST protein
  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQ TNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQA ISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKP VKSPDNSIKMPEEEDEAPVLDVRYASAS
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      305 to 482
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

General Info

  • Alternative names

    • COREST
    • KIAA0071
    • Nr2b2
    • Nuclear receptor coregulator 1
    • Nuclear receptor subfamily 2 group B member 2
    • Protein CoREST
    • RCOR
    • Rcor1
    • RCOR1_HUMAN
    • REST corepressor 1
    • Retinoic acid receptor RXR-beta
    • Retinoid X receptor beta
    • Rxrb
    see all
  • Function

    Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the CoREST family.
    Contains 1 ELM2 domain.
    Contains 2 SANT domains.
  • Domain

    The SANT domains may bridge the nucleosomal substrates and the demethylase KDM1A.
  • Post-translational
    modifications

    Phosphorylated by HSV-1 protein kinases in case of infection.
  • Cellular localization

    Nucleus. Upon infection by HSV-1, it is partially translocated into the cytoplasm in an HSV-1-dependent manner.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 2 µg ab196077 with Coomassie staining.

References

ab196077 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up